LexisNexis

AI Software Engineer

LexisNexis  •  €49k - €82k/yr  •  Kingdom of the Netherlands (Onsite)  •  5 days ago
Apply
AI can make mistakes so check important info. Chat history is never stored.

Job Description

AI Software Engineer

What if your next role allowed you to shape AI-powered experiences that help professionals make better, faster decisions using trusted fiscal data?

Are you excited by building practical AI solutions, collaborating across disciplines, and turning emerging technology into valuable customer outcomes?

About the Business

LexisNexis Risk Solutions provides customers with solutions and decision‑making tools that combine public and industry‑specific information with advanced technology and analytics to help them evaluate and predict risks and improve operational efficiency.

We use the power of data and advanced analytics to help our customers make better and faster decisions. By making information clearer and more actionable, we ultimately help make communities safer, insurance pricing more accurate, trade more transparent, business decisions simpler, and processes more efficient.

For more information about LexisNexis Risk Solutions, please visit:
https://risk.lexisnexis.com

Taxes are complex. We make them manageable.

At Nextens, we build tax and compliance software that thousands of professionals rely on to stay compliant, work efficiently, and deliver accurate results. Our platform supports around 1 million filings every year, helping organizations navigate a constantly changing fiscal landscape with clarity and confidence.

About Role

We are looking foranAISoftwareEngineerto helpexpand AI capabilities across our tax-focused product ecosystem.Therole supportsour AI-powered taxassistant, butis broader thanRAGalone: italsoincludesgenerative AI features,workflow automation,andAI-powered insightsfromfiscal dataThisisamediorrole for someone who can contribute independently to well-definedengineering tasks, work closely withsenior engineers and domain experts, and grow their AIexpertisewhile delivering practical product value.

RoleScope

You willcontribute tobuilding,testing, andimprovingAI capabilitiesinourproducts and internal workflows.Workmay include RAG, LLM-powered assistants, structured outputs, workflow automation,AI-generated fiscal insights, data analysis workflows,evaluation,backend services, APIs,andlimitedfrontend integrationwhere needed.Themain focusis AI, Python/backend, APIs, data, and integration work; C#, .NET, Angular, and TypeScript are useful but not core expectations.We expect a curious, pragmatic mindset: someone who asks good questions, learns quickly, collaborates well with engineers and domain experts, and focuses on delivering reliable value.

Responsibilities

  • Build and improve AI-powered product features, including assistants, RAG capabilities, workflow automations, and fiscal insight-generation features.
  • Develop AI application components such as data ingestion, retrieval, prompt orchestration, structured outputs, evaluation support, and monitoring hooks.
  • Work with tax/domain experts to ensure AI outputs are accurate, explainable, grounded in fiscal data, and useful to users.
  • Support evaluation and improvement of AI systems by reviewing model behavior, feedback, test cases, and production signals.
  • Collaborate with product, frontend, and engineering colleagues to turn AI capabilities into usable product experiences.

Requirements

  • Experience as a software engineer, AI engineer, data engineer, machine learning engineer, or similar role.
  • Good Python skills and experience building backend, data-driven, automation, or AI/LLM-powered application components.
  • Familiarity with LLM application patterns such as RAG, embeddings, vector search, prompt engineering, structured outputs, and context management.
  • Experience or strong interest in AI orchestration frameworks such as Pydantic AI, LangChain, LangGraph, or similar tools.
  • Ability to work with structured or semi-structured data to generate insights, summaries, recommendations, or decision-support features.
  • Basic understanding of evaluation, monitoring, testing, secure development, data privacy, and responsible AI principles.
  • Familiarity with C#, .NET, Angular, or TypeScript is a plus, but deep expertise is not expected.

Risk benefit statement

Learn more about the LexisNexis Risk team and how we work https://relx.wd3.myworkdayjobs.com/RiskSolutions/page/21c296c982531000b79663f3194b0000

Dutch Version Job Description

AI Software Engineer

Benjijeensoftware engineer met interesse in AI,generatievetoepassingenenslimmeautomatisering?

Wil jewerkenaantechnologiediefiscaleprofessionalshelptomsneller,betrouwbaarderenefficiëntertewerken? Danzoekenwijjou

Introductie

Alsvoorloperop hetgebiedvan AIbinnenfiscalesoftwareontwikkelenwijoplossingendiecomplexefiscalekennistoegankelijkerenpraktischermaken Voor deverdereuitbreidingvanonzeAI-mogelijkhedenzoekenwijeenAI Software Engineer die meewilbouwenaanslimme,betrouwbareenschaalbareAI-functionaliteitenbinnenonsproductecosysteem

IndezemediorrolwerkjeaanmeerdanalleenRAG ofchatfunctionaliteit JedraagtookbijaangeneratieveAI-toepassingen,workflowautomatisering, data-analyse, AI-gedreveninzichtenenintegratiesmetbestaandeproducten Jewerktnauwsamenmet senior engineers,productcollega’senfiscaledomeinexpertsom AI-oplossingenteontwikkelendie directwaardeleverenvooronzegebruikers

Wat ga jedoen?

Als AI Software Engineer bouw, testenverbeterje AI-functionaliteitenbinnenonzeproducteneninterne workflows. JewerktonderandereaanLLM-gedrevenassistenten, retrieval-encontextmechanismen,gestructureerdeoutput, data-ingestie,evaluatieflows,backendservicesenAPI-integraties

Denadrukligtop AI, Python/backend development, dataenintegratiewerk Kennis van C#, .NET,Angular ofTypeScript ismooimeegenomen, maargeenvereisteBelangrijkerisdatjenieuwsgierigbent,snelleert,goedevragensteltenpragmatischwerktaanoplossingendiebetrouwbaarenbruikbaarzijnin depraktijk

Belangrijksteverantwoordelijkheden

Indezefunctiehoudjejeonderanderebezigmet:

  • Hetontwikkelenenverbeterenvan AI-gedrevenproductfunctionaliteiten,zoalsassistenten, RAG-oplossingen,workflowautomatiseringentoepassingenvoorfiscaleinzichten

  • Hetbouwenvan AI-componentenvoordata-ingestie, retrieval,promptorkestratie,gestructureerdeoutput,evaluatieenmonitoring.

  • Hetvertalenvanfiscaleenproductinhoudelijkebehoeftennaarbetrouwbaretechnischeoplossingen

  • HetsamenwerkenmetfiscaledomeinexpertsomervoortezorgendatAI-outputaccuraat,uitlegbaarenbruikbaaris.

  • Hetondersteunenvanevaluatieenkwaliteitsverbeteringdoormodelgedrag, feedback, testcasesenproductiesignalenteanalyseren

  • Hetsamenwerkenmet product-, frontend-enengineeringteamsom AI-functionaliteitenomtezetteningoedegebruikerservaringen

Watvragenwij?

Wijzoekeniemanddieervaringheeftmetsoftwareontwikkelingeneensterkeinteresseheeftin AI-toepassingen Jehoeftnietallesalvolledigtebeheersen, maar jehebtweleenstevigetechnischebasisendemotivatieom jeverderteontwikkelenbinnenAI-engineering.

Jebrengtbijvoorkeurhetvolgendemee:

  • Ervaringalssoftware engineer, AI engineer, data engineer, machine learningengineer ofineenvergelijkbarerol
  • Goedekennisvan Pythonenervaringmet backend-, data-,automatiserings- of AI/LLM-gedrevenapplicatieontwikkeling
  • Bekendheidmet LLM-toepassingenzoalsRAG, embeddings, vector search, prompt engineering,gestructureerdeoutputencontextmanagement
  • Ervaring met of interesse in AI-orkestratieframeworkszoalsPydanticAI,LangChain,LangGraphofvergelijkbaretools.
  • Hetvermogenomtewerkenmetgestructureerdeofsemigestructureerdedata.
  • Basiskennisvanevaluatie, monitoring,testen, secure development,dataprivacyenresponsible AI.
  • Kennis van C#, .NET,Angular ofTypeScript iseenpré, maargeenhardeeis

Wie benjij?

Je bentnieuwsgierig,analytischenpragmatisch JevindthetinteressantomnieuweAI-mogelijkhedenteonderzoeken, maarverliesthetpraktischeresultaatnietuithetoog Jewerktgraagsamenmet engineers,productcollega’sendomeinexpertsenkunttechnischekeuzeshelderuitleggen

JevoeltjeprettigineenomgevingwaarinAIzichsnelontwikkeltenwaarinnognietallesvoorafvaststaat Jedenktmee,experimenteert,leertsnelenhelptomideeënomtezetteninwerkendeoplossingendiegebruikersechtverderhelpen


Primary
Location Base Pay Range: NLD Amsterdam (Radarweg) €49,000 - €81,700.

We know your well-being and happiness are key to a long and successful career. We are delighted to offer country specific benefits. Click here to access benefits specific to your location.

We are committed to providing a fair and accessible hiring process. If you have a disability or other need that requires accommodation or adjustment, please let us know by completing our Applicant Request Support Form or please contact 1-855-833-5120.

Criminals may pose as recruiters asking for money or personal information. We never request money or banking details from job applicants. Learn more about spotting and avoiding scams here

Please read our Candidate Privacy Policy

We are an equal opportunity employer: qualified applicants are considered for and treated during employment without regard to race, color, creed, religion, sex, national origin, citizenship status, disability status, protected veteran status, age, marital status, sexual orientation, gender identity, genetic information, or any other characteristic protected by law.

USA Job Seekers:

EEO Know Your Rights

LexisNexis

About LexisNexis

LexisNexis is a leading innovator of private, secure, and authoritative Legal AI solutions that help legal and business professionals draft full documents with ease, make informed decisions faster, and deliver outstanding work and improved outcomes, all powered by trusted content. LexisNexis Legal & Professional serves customers in more than 150 countries with 11,800 employees worldwide, and is part of RELX, a global provider of information-based analytics and decision tools for professional and business customers.

Industry
IT & Software
Company Size
10,000+ employees
Headquarters
New York City, NY
Year Founded
1970
Social Media